PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.XLI8D
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family ARR-B
Protein Properties Length: 534aa    MW: 60439.5 Da    PI: 5.5133
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.XLI8DgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like77.71.5e-24206259155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  k+r++W+ +LH++Fv+av+q+ G +k  Pk+il+lm+v+ Lt+e+v+SHLQkYRl
  Araip.XLI8D 206 KARVVWSVDLHQKFVQAVNQI-GFDKVGPKKILDLMNVPWLTRENVASHLQKYRL 259
                  68*******************.9*******************************8 PP

2Response_reg81.23.3e-27211291109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl+vdD+p+ +++l+++l+k  y +v+++  ++eal++l+e++  +D+++ D++mp+m+G++ll++   e  +lp+i+++  ge + + + ++ Ga 
   Araip.XLI8D  21 VLVVDDDPTWLKILEKMLKKCSY-QVTTCCLATEALKKLRERKdaFDIVISDVNMPDMNGFKLLEHVGLEM-DLPVIMMSVDGETSRVMKGVQHGAC 115
                   89*********************.***************888889**********************6644.8************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+ ++el++
   Araip.XLI8D 116 DYLLKPIRMKELRN 129
                   ***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363924.4E-1442501IPR017053Response regulator B-type, plant
SuperFamilySSF521726.83E-3618143IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23003.2E-4418142No hitNo description
SMARTSM004482.3E-3119131IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.63120135IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.4E-2421130IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.97E-2922135No hitNo description
SuperFamilySSF466891.97E-17204263IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.7E-28204264IPR009057Homeodomain-like
TIGRFAMsTIGR015574.8E-22206259IPR006447Myb domain, plants
PfamPF002491.3E-7208258IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 534 aa     Download sequence    Send to blast
MDNNGCLPCT RREGFPAGLR VLVVDDDPTW LKILEKMLKK CSYQVTTCCL ATEALKKLRE  60
RKDAFDIVIS DVNMPDMNGF KLLEHVGLEM DLPVIMMSVD GETSRVMKGV QHGACDYLLK  120
PIRMKELRNI WQHVLRKRIH EGREFESLEG FDFEGIHHLM RNGQDQCCDD VSLFALEDCI  180
SSTRKRKDAD NKHDEREFGD SSSTKKARVV WSVDLHQKFV QAVNQIGFDK VGPKKILDLM  240
NVPWLTRENV ASHLQKYRLY LSRLQKQRDQ KKCSSSGIKN PDLNPKDPGS SSIKNSMNKQ  300
QNVVSIDGFR CPNNGLVQLH ESDFTVSELN KTEQRRALAT NNIIPDPNMT KVSQIVLNQT  360
FSPLNSEGNI EVFDCTIPTQ YTWNQVPKRK LQDDPKSQSI ASMVSSPSAA SSIASSAVDN  420
IIPVQSKSLM VNDQSSVTSN PGLKTQEFDA SLIPELEFYQ QNLLWGGEAA FSPLEEDLNF  480
FLLQSECYND MNFGMHNIDT SDYYYDPGLI ADVPNHLLYD SADYSVVDQS LFIA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-17202264163ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016191131.10.0PREDICTED: two-component response regulator ARR11-like isoform X1
TrEMBLA0A0B2SM230.0A0A0B2SM23_GLYSO; Two-component response regulator ARR11
TrEMBLI1K3I80.0I1K3I8_SOYBN; Uncharacterized protein
STRINGGLYMA05G27670.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39993360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67710.11e-121response regulator 11